FGF1(NM_000800)Human Recombinant Protein人重组蛋白

 Product Data
Description Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence >RC207434 protein sequence
Red=Cloning site Green=Tags(s)

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY
IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY
GQKAILFLPLPVSSD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.3 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]
Protein Families Druggable GenomeSecreted Protein
Protein Pathways MAPK signaling pathwayMelanomaPathways in cancerRegulation of actin cytoskeleton

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.